SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1JIC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1JIC6
Domain Number 1 Region: 17-130
Classification Level Classification E-value
Superfamily L domain-like 2.58e-27
Family Internalin LRR domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E1JIC6
Sequence length 232
Comment (tr|E1JIC6|E1JIC6_DROME) Uncharacterized protein, isoform F {ECO:0000313|EMBL:ACZ94614.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG14995 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSRLTEEMVIARAKQSDLSLIKKLNCWGSDLSDVSIIKRMRGVEVLALSVNKISTLSTFE
DCTKLQELYLRKNSISDINEIAYLQNLPSLRNLWLEENPCCERAGPNYRSIVLRALPNLK
KLDNVEVTQQEVEDALRGGGVAAPEDEVYEDAYQQQQQSRRSSPQQILQQQQHSYPQHSP
PPQQQYQQQQQQQQQQQRGCTTPTKEVSGCHCLCGFSHTTPRFSCYNLLPWQ
Download sequence
Identical sequences E1JIC6
FBpp0290099 NP_001163342.1.81976 FBpp0290099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]