SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1JJ60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1JJ60
Domain Number 1 Region: 29-174
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000000453
Family Haloperoxidase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1JJ60
Sequence length 211
Comment (tr|E1JJ60|E1JJ60_DROME) CG2082, isoform M {ECO:0000313|EMBL:ACZ94818.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG2082 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSIADKRASFARRAESLVERVRVMNTIYEKYNISTEKCGDLTVIVQGDLSQQEKRAVFIT
VHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALADGFPFPSLQSLGEDL
VTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSAASVVQSFKNKFIS
WKSDEVAQSAESFLMYHKFGHVMEVNRSNVS
Download sequence
Identical sequences E1JJ60
FBpp0290134 NP_001163519.1.81976 FBpp0290134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]