SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1QSZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E1QSZ9
Domain Number - Region: 3-51
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000446
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1QSZ9
Sequence length 68
Comment (tr|E1QSZ9|E1QSZ9_VULDI) Uncharacterized protein {ECO:0000313|EMBL:ADN50866.1} KW=Complete proteome; Reference proteome OX=572478 OS=IC-017). GN=Vdis_1480 OC=Thermoproteaceae; Vulcanisaeta.
Sequence
MPTCKLCGRSFDTLTELYVHLSSECNKIPRSRRCPVCGSKYRSIRFMKHHLINEAFIESK
HMSYLISI
Download sequence
Identical sequences E1QSZ9
gi|307595600|ref|YP_003901917.1| WP_013336591.1.43420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]