SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1QX06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1QX06
Domain Number 1 Region: 68-448
Classification Level Classification E-value
Superfamily Serpins 2.88e-73
Family Serpins 0.0000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1QX06
Sequence length 451
Comment (tr|E1QX06|E1QX06_OLSUV) Proteinase inhibitor I4 serpin {ECO:0000313|EMBL:ADK68659.1} KW=Complete proteome; Reference proteome OX=633147 OS=NCIMB 702895 / VPI D76D-27C) (Lactobacillus uli). GN=Olsu_1560 OC=Atopobiaceae; Olsenella.
Sequence
MERPIERRTALALLGLPLALSLGSSLAGCGVGGNPDDVPPLLAASDLTAGVGDSASVRGA
QAPIGDTLTDQAATLAAYDFAARLLQGCYKAEPGGNVLVSPLSALFALALAENGAAGETL
SQMEAATGMGVRDLTSYLEAYARRIGGEPLYDTQGTGEALALRSANSVWLRDSGGLSVTD
DYLATCKDDLFAQAFSAPFDETTRRDINSWVSSKTDGMIEGMVDEISDEARLFLINALAF
DGAWSDPYKDDDVRDDTFTAVDGTGQDVRMMRSHESHYLENGFAEGFMRPYENHDFAFVA
LLPKGGVGIGDLVGSLDGGSLHELVTGAVPDVEVSAGLPKFTASHRTLLDEQLHSMGMLD
AFEPSLADFSPLGSVPDGNLAVGSVIQKTFVDVNEQGTRAAAATSVEMETTAARPSDPEV
REVVLNRPFVYLIIDYQSATPLFAGVVTSMA
Download sequence
Identical sequences E1QX06
WP_013252411.1.19134 WP_013252411.1.33448 gi|302336332|ref|YP_003801539.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]