SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1QYF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1QYF3
Domain Number 1 Region: 92-226
Classification Level Classification E-value
Superfamily Sortase 2.35e-42
Family Sortase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1QYF3
Sequence length 282
Comment (tr|E1QYF3|E1QYF3_OLSUV) Sortase family protein {ECO:0000313|EMBL:ADK67417.1} KW=Complete proteome; Reference proteome OX=633147 OS=NCIMB 702895 / VPI D76D-27C) (Lactobacillus uli). GN=Olsu_0293 OC=Atopobiaceae; Olsenella.
Sequence
MKRHLSTILLAFALLVGMGLLVYPSASDWWNSFHQSQAIAGYIRQVESNPDEENQAIWDA
AVAYNQGLDTSDGRFVLSSEEKEVYEGMLDVTGTGIMGYVSIPKISVSLPIYHGTDDTVL
QIAIGHIPGSSLPVGGEGTHTVISGHRGLPSARLFTDIDQLAEGDHFVLHVLGRTLTYEI
DQILTVPPDDLDALGIEGRQDLCTLVTCTPYGVNTHRLLVRGHRVPNDPEPSDGDVRTIG
CLPFVGAFAGAGLVILVTTGLARRKRGKPHDGPRHARRMGRR
Download sequence
Identical sequences E1QYF3
gi|302335090|ref|YP_003800297.1| WP_013251169.1.19134 WP_013251169.1.33448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]