SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1U2K4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1U2K4
Domain Number 1 Region: 201-296
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.83e-29
Family B3 DNA binding domain 0.0000149
Further Details:      
 
Domain Number 2 Region: 65-121
Classification Level Classification E-value
Superfamily DNA-binding domain 1.57e-17
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E1U2K4
Sequence length 372
Comment (tr|E1U2K4|E1U2K4_SOLLC) RAV1 {ECO:0000313|EMBL:ABY57634.1, ECO:0000313|EnsemblPlants:Solyc04g007000.1.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101259430 OC=Solaneae; Solanum; Lycopersicon.
Sequence
MEVSCIDQEISTTSDSPSTISPAGSPRQMGSGVSVVTDADSTNGVEAESKNTTITNNNNN
KLPSSKFKGVVPQPNGRWGAQIYEKHQRIWLGTFNGEEEAARAYDIAAQRFRGRDAVTNF
KPLFDFQTEEIEISFLNSRSKVEIVEMLRKHTYNDELQHAKKVYNNNTFEMNGRSTCHTN
TNIATFSLDTNEKVANIASELLFEKVVTPSDVGKLNRLVIPKQHAERYFPLVAKVNKNDN
TSKGVLLNFEDMNGKMWRFRYSYWNSSQSYVLTKGWSRYVKEKKLKAGDIVSFKRCSGVE
IEDKLLIDSKNRIIRGEQVKMVRLFGVNICKVQDVSNNVVVEKNMSVGKRMREMELLAFE
CSKKQRVIIDAL
Download sequence
Identical sequences E1U2K4
XP_004236999.1.44838 Solyc04g007000.1.1 Solyc04g007000.1.1 Sopim04g007000.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]