SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1WL93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1WL93
Domain Number 1 Region: 20-285
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.01e-39
Family Glycosyl hydrolases family 16 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1WL93
Sequence length 307
Comment (tr|E1WL93|E1WL93_BACF6) Putative endo-beta-galactosidase {ECO:0000313|EMBL:CBW21256.1} KW=Complete proteome OX=862962 OS=Bacteroides fragilis (strain 638R). GN=BF638R_0672 OC=Bacteroides.
Sequence
MNTTGRLSFHPSEIPTVFKSPITGRTYHLVFNDEFDDGVIDTLKWDTRSRRSPFTRRGMY
QEKPYYVLCHEDWTKELHGELRLEVSKYPTQNNVVMTGGILSLGRFMARYGYYETKASFR
DCIGEGYWPAFWIHFDEADKYGKGTEIDVFEYIPKDKQIFQTLHWYKKQAMEEQQSEVQH
AALDYDKSGQFKEHRSSTKYFVLDEAQSKEHTFAVEWTPEELIFYTDGKVTRRVNRKDDP
KQVPSAYQMVYFSCSAGEWGGNVMENQVPAYVYFDYCRCYQESDQDAIYTVKGNGMKVPA
SRRVGKL
Download sequence
Identical sequences E1WL93 Q5LHK3
gi|375357035|ref|YP_005109807.1| gi|60680191|ref|YP_210335.1| NYSGXRC-11268b 272559.BF0629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]