SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2A5G4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2A5G4
Domain Number 1 Region: 21-265,336-385
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.51e-104
Family Type II chitinase 0.00000097
Further Details:      
 
Domain Number 2 Region: 265-335
Classification Level Classification E-value
Superfamily Chitinase insertion domain 8.64e-23
Family Chitinase insertion domain 0.00026
Further Details:      
 
Domain Number 3 Region: 420-480
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000837
Family Tachycitin 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2A5G4
Sequence length 481
Comment (tr|E2A5G4|E2A5G4_CAMFO) Acidic mammalian chitinase {ECO:0000313|EMBL:EFN71329.1} KW=Complete proteome; Reference proteome OX=104421 OS=Camponotus floridanus (Florida carpenter ant). GN=EAG_05602 OC=Vespoidea; Formicidae; Formicinae; Camponotus.
Sequence
MNCWIFIFALAALASAAHSEKKIVCYFGSWAVYRPSDGKFDISDIPSDLCTHFIYSFVGL
TTDANVKVLDEWLDLPNNGGKNAFGRFNKLREQNPGIKTLIAIGGWNEGSTKYSQVVASQ
TLRTKLVKSMVEFTMKYGFDGLDIDWEYPNQRGGKPEDVQNFVKLLQELRPEFDKHKLLL
TAAVAAAEPSASLSYDIPAISKYLDFINVMTYDLYGPWDKTTGLNAPLYSGHGSFELKLN
VDACVRYWLKNGCPPEKLIVGVPSYGRTFTLANKNEYGLGTPARGPGTAGPYTREAGMLG
YNEICVLIKEGGWTITRSEGHDVPYAFKNDQWISYDDVTSLNEKANYINSLNLGGAMIWS
IETDDFRGKCGKQYPLLKTLNAKLRGKVIPIEPSKPTDSPKETNPPKPSTVQPTQPPATA
PPNGICKKVGYVRDKEDCNVFYQCLDINGTYKIEKFNCPSGLGFDDKSNVCNYKKFVNGC
I
Download sequence
Identical sequences E2A5G4
XP_011251921.1.72520 XP_011251922.1.72520 Cflo_09529--XP_397146.3_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]