SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2AC15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2AC15
Domain Number 1 Region: 956-1249
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 9.58e-88
Family Complement components 0.0000149
Further Details:      
 
Domain Number 2 Region: 1319-1450
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 6.8e-33
Family Alpha-macroglobulin receptor domain 0.00045
Further Details:      
 
Domain Number 3 Region: 788-901
Classification Level Classification E-value
Superfamily E set domains 0.00000000132
Family SVA-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2AC15
Sequence length 1762
Comment (tr|E2AC15|E2AC15_CAMFO) Alpha-2-macroglobulin-like protein 1 {ECO:0000313|EMBL:EFN69033.1} KW=Complete proteome; Reference proteome OX=104421 OS=Camponotus floridanus (Florida carpenter ant). GN=EAG_13483 OC=Vespoidea; Formicidae; Formicinae; Camponotus.
Sequence
MLIGLETCLELAVPFTRYFNGRLRLKIKFDKHPDYIVETEKKIYIEHDSIITFVETDKPV
YKPGQDVNIRILMLKHDLKPWKKTIPKVWIENPSEVRVAQWTNVSTENGMTQLKFALSPE
PSPGAWKIKVEKTRSQPQLIHTTVFEVKKYVLPRFQVTVTSPGYILADAENVTWNICAKY
SYGKPVKGRLLLKSTPQIPIWRRKPNLPEIHYETELDSSDGCTEFVLSGAVLGLAQWKVA
PNNIVLIANFTEAGTGIVETTISRTVVVHQALKLEFLPYTPKYFKLGLPYHGKLRVSRHD
DTPAPHEKIQLCVRVRGEDDWLRVVVECRNFTSSSDGFVDFVVPPPHRNIVLLNFIATGV
DYPTKYYSPDTRWRVFMDQPSAHIVVNPWYSPSDSYLAVARGYQPIICGEKYSFNVMYTV
PAKSKTNESISFHYSINSKGDLLIYGHVKHKPTRDMVLNYSEFRNLFGAVETSGNKTNQD
TIVHRFPLSVKITPSMAPVSELLLYYVRPDGEIVATTYSIKVGHCFENKVKSAWHTDAQT
PGTVTQYHVEAAPWSLCGISAVDKSTRFLGSKANLIDADQTFEQLKRFYIEPELRPIWTQ
CKVTTQQETNTEEIDHLPIPLWGRRKKRTVISPGPYSGLTNYVDAIQAFDDFGAVVMSDL
ILETRPCPQLHRMDRFRSSTIQTFFLRSTSVLESEAGMFKMAAKTLPMAYPLLNEGPEQA
YVDQVPDQPATLRSYFPETWLWELVPTGKEGKVAIERTLPHTITDWVGYTTCISSTHGLG
IAPPTTITGFQPFFLDYSLPYSVKRGEMLHMKVSLFNYMQHSLPVKIKLEDATGLDLHLS
HAVASFCVKPRDSVVHEYILRPRVLGDVNITVSASVDSEYGEPCGPEVLLYTRDVIVKSI
LVLPEGFPVEATKSAFICPKDFSDDSTITWHLDLPDDLVPESARGYVSMIGDILGPALEN
LDNLVRLPMGCGEQNMILFVPNIHVIGYLDTTGVENPELRAKAVRNMEKGYQRELIYRHP
DGSYSAFGPNVTEDGSSIWLTAFVIKSFAQAKNIIHIDERDLKISVKWMLKKQLENGCFP
MIGRVFHKDMKGGLQDDDSSSSALTAYILISLLESGVPLTATLINNALHCLEKGMENGGG
TTYTAAISTYALSLLEHPKANNSMKLLMERATRNNDLLWWEDKPSLGLSIEMTAYAVLSL
VKLGGEANMVEALKAVRWMSKQRNAEGGFTSTQDTVLGLEALTKYAAAMSNDNTDLSVLV
TGNEVDQLYRMHNDNRMVLTQIRLPVIPTIIEIFAEGEGCVLVQSNIKYNVAHATGSEAF
DLSVNAASSTWVDECSMQKITICTRYKMADGESNMAVLEVGMISGYIPDRTSLHSLLEDP
ATKVKRFEEDRDVVTIYFDKLINQKTCISFMVTRENVVDRLEPANVKLYDYYQQELTISS
SYSFAPTCSSATPNEETEIPDPVPVEVEQLDKDATKIAKKDERIEKAAEIPDAQNGTVEQ
IVPRAEIGSGQTPDEPDINLNPVFDRLGPPNVDLEDMEASFSVFNGQNQDPFPANFDGNP
LFVVVDHELATPDGVEGPVSVSVKPDINFDGDQLSNVTNQSAERIDTDSSNTQLQTSPPL
ASNESCPICADELPLNINEIYCSSSSVVKAAIRRLRKVRLLLDIQPLHEIKRLRSTVEFI
LNPKCSCSPLDNPGTLALLMHSGDSEFAIRSHNSQHIRVVALDERTSIYGLQSHSGVPDE
LINARKICATRDKTSLNLPTTG
Download sequence
Identical sequences E2AC15
Cflo_05996--XP_392454.2_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]