SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2AH08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2AH08
Domain Number 1 Region: 3-329
Classification Level Classification E-value
Superfamily Sema domain 1.19e-102
Family Sema domain 0.000000663
Further Details:      
 
Domain Number 2 Region: 334-368
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000628
Family Plexin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E2AH08
Sequence length 772
Comment (tr|E2AH08|E2AH08_CAMFO) Semaphorin-1A {ECO:0000313|EMBL:EFN67280.1} KW=Complete proteome; Reference proteome OX=104421 OS=Camponotus floridanus (Florida carpenter ant). GN=EAG_06217 OC=Vespoidea; Formicidae; Formicinae; Camponotus.
Sequence
MHVSEGQLYAATVADFTGGEPLIHREKIRTERSDLNQLNGPNFVSSFAYQDYVFFFYRET
AVEYMNCGKAVYSRVGRVCQHDKGGPHAFSDRWTSFLKARLNCSVPGEYPFYFNEIQSTS
DVTEGRYAGKSARLVYAVFTTPVNSIGGSAVCAFSMDNILEVFQSAFKEQETINSNWLRV
LPEKVPEPRPGACVNDSRTLPDITVNFVKAHPLMDDAVQSYFSLPVITKTSFNYRFTKVV
VDSQVKALDGKAYDVLYIGTDDGRVLKALNTRAPETRVNVSQVIVSDVQVLKFGQAVKDL
LVVHLAGEASKLMVFADSEIRAVPLHHCDSPAAATCKTCVALQDPHCAWDAIANLCVAVP
TKLHDSDNSKTLFQDIPTGRHRNCGYEQEMTKPVQPAAAPEIGRDEQPDERDNEIVIELD
RENQYGRTQPRANEPQGVTVTPVVYSAQTLTGALIGTCLCSLVAGFAFGFWFSQRLRGSS
YPEPSEQRQQLNRLTESSESPGFNNKSINLVLNVPPKNPNGKNANSSAENKPVQKDPTGS
GASSISSSSDIAESDERNEEDGDDDEDDDGTTPPTSLTTGIATDHTNNTHKLDEDRYEDH
YESIVNDETCMLEYCDPYESTQQRSIPTAPKCVRYHQSVECVETTLINAPPTCELEDTGS
SDSANSLDDLCGSHRSTVDDNRFDRHGELTNNGRDHYMVPTRNPRELNERILSLFNPQFL
PNFNNMITYVASPPSRSQSMAQYNSEDDNFLLRNTNYRKHTTPRTRCVFDAN
Download sequence
Identical sequences E2AH08
Cflo_07915--XP_392255.3_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]