SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2B169 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2B169
Domain Number 1 Region: 30-97
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000889
Family Tachycitin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E2B169
Sequence length 129
Comment (tr|E2B169|E2B169_CAMFO) Uncharacterized protein {ECO:0000313|EMBL:EFN60561.1} KW=Complete proteome; Reference proteome OX=104421 OS=Camponotus floridanus (Florida carpenter ant). GN=EAG_13036 OC=Vespoidea; Formicidae; Formicinae; Camponotus.
Sequence
MSKLMEQALKLSTQVKAQDEEGGDGTDPNAEELCQDRPGDEYFRLSVEGDCRDVVRCDKA
SEIGVTRLATVRCPTGLAFDIERQTCDWKTNVKNCDQLESKRHVFFSELDSRKHPLFSVP
VPPGVQGPV
Download sequence
Identical sequences E2B169
Cflo_09886--XP_623723.2_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]