SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2B171 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2B171
Domain Number 1 Region: 181-489
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.16e-39
Family NodB-like polysaccharide deacetylase 0.018
Further Details:      
 
Domain Number 2 Region: 78-119
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000199
Family Tachycitin 0.018
Further Details:      
 
Domain Number 3 Region: 133-172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000072
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E2B171
Sequence length 555
Comment (tr|E2B171|E2B171_CAMFO) Uncharacterized protein {ECO:0000313|EMBL:EFN60563.1} KW=Complete proteome; Reference proteome OX=104421 OS=Camponotus floridanus (Florida carpenter ant). GN=EAG_13038 OC=Vespoidea; Formicidae; Formicinae; Camponotus.
Sequence
MRSSLVLLLVAAFVLAGECQISLPALSLADAKIPLFHFLEGSTRVKRQEEKKEESFENEI
CKDKDAGEWFRLVAGEGDNCRDVIQCTSSGLQAIRCPAGLYFDIDKQTCDWKDSVNNCKL
KNKERKAKPLLYTEEPLCQDGFLACGDGSCIERGLFCNGEKDCTDGSDENICDMDNDPNR
APPCDPAVCVLPDCFCSEDGTTIPGDLPGKDVPQMVTITFDDAINNNNIGLYKEIFNGKR
KNPNGCDIKATFFVSHKYTNYSAVQEMHRKGHEIAVHSISHNDDERFWSDATVDDWAKEM
AGMRIIAEKFANLSDNSVVGVRAPYLRVGGNNQFTMMEEQAFLYDSTITAALNNPPLWPY
TMYFRMPHRCHGNLQHCPTRSHAVWEMVMNELDRREDPQNDEYLPGCAMVDSCSNILTGD
QFYNFLNHNFDRHYEQNRAPLGLYFHAAWLKNNPEFLDAFLYWIDEILQSHTDVYFVTMT
QVIQWIQNPRTVTESKNFEPWREKCVVEGPPACWVPHTCKLTSKEVPGETINLQTCVRCP
NNYPWVNDPTGDGFF
Download sequence
Identical sequences E2B171
Cflo_09888--XP_391915.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]