SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2B5T3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2B5T3
Domain Number 1 Region: 117-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000204
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2B5T3
Sequence length 175
Comment (tr|E2B5T3|E2B5T3_HARSA) Uncharacterized protein {ECO:0000313|EMBL:EFN88902.1} KW=Complete proteome; Reference proteome OX=610380 OS=Harpegnathos saltator (Jerdon's jumping ant). GN=EAI_10847 OC=Vespoidea; Formicidae; Ponerinae; Ponerini; Harpegnathos.
Sequence
MLIRNIQVRALKHLKVRPVRFLSEEHLHRESTVARLLHPTHCFSEGGFHTITSNQSVSRY
ESAAIISSEGCELDQMRHGCRIHNAKCKCGHGCKSEYRYNNTDDCELALKGRRSDLCSRS
KPCQNEGSCSQISSDPGFKCRCEGTGFYGTYCEIPCPKTNSPHFQGQFPYECIVI
Download sequence
Identical sequences E2B5T3
Hsal_01771--XP_001606809.1_NASVI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]