SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2BQD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E2BQD6
Domain Number - Region: 2-20
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0138
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2BQD6
Sequence length 100
Comment (tr|E2BQD6|E2BQD6_HARSA) Uncharacterized protein {ECO:0000313|EMBL:EFN82100.1} KW=Complete proteome; Reference proteome OX=610380 OS=Harpegnathos saltator (Jerdon's jumping ant). GN=EAI_11827 OC=Vespoidea; Formicidae; Ponerinae; Ponerini; Harpegnathos.
Sequence
MRCDCLDGYVGHNCETRLLDILDTECASENCILQCPFDEQQQQQPCTCKDGTKIYNNRSR
YECRIKLSNVTSLRTGLISQHGSLESFVSKQVSGQHERSV
Download sequence
Identical sequences E2BQD6
Hsal_09448--XP_001606641.1_NASVI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]