SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2PAK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2PAK5
Domain Number 1 Region: 9-159
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.02e-47
Family Glutathione peroxidase-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2PAK5
Sequence length 160
Comment (tr|E2PAK5|E2PAK5_MANHA) Peroxiredoxin {ECO:0000313|EMBL:EEY11695.1} KW=Complete proteome OX=669262 OS=Mannheimia haemolytica serotype A2 str. BOVINE. GN=COK_2205 OC=Pasteurellaceae; Mannheimia.
Sequence
MEKLQMNILQAGDKAPQFTLQNQADESVSLSQFAGKKVLVYFYPKALTPGCTTQACGLRD
SKSELDELNVVVLGISTDLPKKLAQFVEKKALNFTLLSDPEHQVAEAFGVWGEKKFMGKT
YDGIHRISFLIDEQGVVEQVFDKFKTGEHHQMIVDYLRGR
Download sequence
Identical sequences E2PAK5
gi|525657802|ref|YP_008221257.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]