SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2QCJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2QCJ5
Domain Number 1 Region: 579-889
Classification Level Classification E-value
Superfamily TPR-like 2.47e-42
Family Tetratricopeptide repeat (TPR) 0.0039
Further Details:      
 
Domain Number 2 Region: 475-581
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000124
Family Tetratricopeptide repeat (TPR) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2QCJ5
Sequence length 926
Comment (tr|E2QCJ5|E2QCJ5_DROME) CG4050, isoform B {ECO:0000313|EMBL:AAM70854.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG4050 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSTNPNPGIHQYAPSTLPREREREGATNSPQRNLLEFLCICVACIVCYYNSTQCGLVFDD
ISAIRDNKDLRPHTPLINVFLNDFWGTPMRKEQSHKSYRPLTVLTFRFNYLLHALEPFGY
HLVNLLLHLSVCLLWRRVCRLLLRQCAASGSNAISAPSSSSVSQLNTCAFVASLLFAVHP
VHTEAVTGVVGRAELLSSICFLAAFLSYAKSVGDSGCPRRTNWLTLFGCFGSCLLASMLC
KEQGITIAGICVVYELFVVHQLRPLHLCHFVLRLFDERTEQQSPKLANPSGIRRWSSSTL
WKRLSFLVGITLTLLVGRVYVMGSQLPIFTRFDNPASAADTPERQLTYGYLIYLNCWLLL
CPSLLCCDWTMGTVPLLQGFTDSRNITTLLTFLALGAMVAKTCFTRNLALSRTLIMCLGW
MVLPFLPASNLFFPVGFVVAERILYMPSMGYCLLVAYGFEQLQRRGSLSWQRFSQAALAI
LLLTHALKTHQRNLDWRTEYSLFMSGVHVNQRNAKLYNNVGHALENEGKFEEALLYFQQA
VRIQTDDIGAHINVGRTFNNLKRYAEAEQAYVQAKALFPQAKPGVSYHARIAPNHLNVFI
NLANLIAKNQTRLEEADHLYRQAISMRSDYVQAYINRGDILMKLNRTAQAQEVYEQALLY
DNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELYPEHEQALLNSAILLQELGGEEARRV
SRSRLYKVLENDDQNEKVYFNLGMLAMDESSFDEAEQFFKRAIHLKADFRSALFNLALLL
ADTKRPLDAVPFLNQLIRHHPSHVKGLILLGDIYINHMKDLDEAEKCYRSILHYDPHNTQ
GLHNLCVVFVERKRLAKAAACLQYAQRLAPAEDYIGRHLQIVLARLQKINKLPESAPERK
LAYEDYDPLEFKLPQDRPTHKSRKRS
Download sequence
Identical sequences E2QCJ5 Q7K4B6
FBpp0071560 FBpp0071561 NP_477246.2.81976 NP_726030.1.81976 FBpp0071560 FBpp0071561 7227.FBpp0071560 FBpp0071560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]