SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2QCN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E2QCN4
Domain Number - Region: 173-203,577-625,678-731,915-992,1152-1177,1494-1632,1766-1828
Classification Level Classification E-value
Superfamily ARM repeat 0.000211
Family RPA1889-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2QCN4
Sequence length 2492
Comment (tr|E2QCN4|E2QCN4_DROME) Not1, isoform F {ECO:0000313|EMBL:AAM71069.3} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG34407 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MNVESQLKTPPTHIRNLVKHVNKRNFNESSEQINQFVKEHGLEADRSSLRHLFSVINFSD
LVPSVTVQLQAKLLGIQLERQLHSSSFVSNICYAFDQFFASNQKSLKPVAVADLVGQVAR
LTGINKVCECVFALALTHSSYTELKHSARNNLKGSLSELIDSYLGNKGTGPADSGLREIS
FDLLQYLLCCLSEYVQPQVEAQFLIKLREEFPRQAVPLVLAPFLYGSTTATIAGAGASET
DAEAEATTNSNSSSFEADALNEVGIEDIYDHLSEIIFTNQGKNNIMDTSWINLILEIGYE
FTSSVEECKNHLCSRERERAELQSKDVAKIVGLMCRRHSSLLDCNVNLPTPANFWPGQGQ
GGGSNSSGSSQTQITPQQQNPGSSNNNDGSDGNSSSDKKDKKETTEATQTWKPDVFVQAL
KEVVPQLNWKDVCMELDHPEFVLKDRIGLELLLTILRLATGSNIFPHPECIYRHWANTEG
QLSLIATMLKNPDLFSFADFVFSQPALDVLKTAPDADNKEISSWKSLHLVEVLLSIADKG
YYTQVHELFKFPAQNCPDVLFLALLNTSPPMTPLRQDLFNQLIPTFLGNHPNSNVILASA
WSSNNFQLRSNIMNAMSEWYLRGNEFDQVKLSRILDLAQDLKALSALLNARSFLFIIDLA
CLASRREYLKLEKWLTDKIREHGEPFMQAIIKVLHRRCPQVINAKVPEDQLPPKQAQLLP
ETVTTMINCLQTCINNCMQPEMVEVIMQMTANVAIMANKARAQQQQQPGLVPPPPPTILR
GHRGMDLPGGIVPPPPQQPFSGNLNAQMFGPGMDPLTNMSNNLAGLNLSGPNGAFNFGNM
LTSPSRLMTPGANPYPLNLMQMPQAPPPPNVGNLGRMLPGGPQQQTPTPTPTAPNPNNPV
MADLQIPVSKEVEDEVNSYFQRIYNHQPNPTLSIDEVLDILQRFKESSNRREQEVFLCML
RNLFEEYRFFCQYPEKELQITAQLFGGIIDRNLVPTFVALGLSLRCVLDALRKPDGSKLY
YFGVTALDRFRTRLHTYNKYCEHIRSIPHFSDFPPHLIQYVEYGMHGQEPPPQKLIGLSN
TIPSAISSGPGTEPIYRNSSMLGNMPAATPGSGPKSNAAVSHATRMKSIANATNIDTLLV
ANQEEKVTVPPEPVQDKTAFIFNNLSQLNIPQKCDEIKEIMTKEYWPWLAQYLVLKRASM
EFNFHTLYYNFLDALKNGEINRFVTKETLRNIKVLLRSDKGVINFSDRSLLKNLGHWLGM
MTLGRNRPILQLDLDLKSLLAEAYHKGQQELLFVVPFVAKILESSAKSRIFRSPNPWTMG
IMYVLAELHQEPDLKLNLKFEIEVLCKTLNLELAKLRQVIYLKDPNRTHRIEEQMSQPKP
KQLEPVASAPALPREQQSPAQPPPPPQQQQPPQQQVPPPPSSADVDAQNAAAMMMAAGGA
NSTPGSVSSPNLPTDSSQVALPPPEPRYSYVDVNVSNFQLIGQQLVLPPNTPFLHANPGI
KHMVVNAVERTITDWLQPIVDRSIRIACATTEQIIRKDFALDADENRMRTAAHQMVRNLA
AGMAMITGKDEIARAISQNLHKALLSGLNGMPSMAEIQAAAMQLASENVELVCAFIQKTS
AEKAAAEIDRRLSTDFETRKIAREEGNRFVDAQILTYQQERLPEAVRIKVGAAPATLYAV
YSEFARSIPGFQQMSDRDIALFVPKPTDLSQPNVFANDDSMVYGELASKMEAFMNTAIGV
PTLQIQASKMHMLLNALIATRRLRDQESAFNLLTRAVEGLTEGLVNMHENMEQMKMYQNI
HLRILGLLNNSFGAPNTERAVTKCFFDIREEVRYNVEAARALITSHFVNLNQFDGMLRDC
MDNGNNYVAISFGIALLERLIMDDRVINIVSDNEFMATVELLGRLTQHRHRYPECIVNAI
DTLWSGNFNSSSDYSPFNGNDRYLSGASHYIHSGMHHVRSCDTDDPPGLQEKTEFLLKDW
VALYTQQNQQSTRDARNFGAFVQKMNTYGILKTDDLITRFFRQATHICTDVVYRMFAEPS
LPINQAKNKIFQWIDAFVHLIAMLVRHSGEAGNPTTKINLLNKVLGIVLGTLIKDHEMRG
VSFQQVGYHRFFMMLFMELCTADVILESLMHSIVSAFAYTYHLLNPSVAPGFCFAWLELI
SHRVFLGRILVQIPGQKGWPLYAQLLQDLFKYLAPFLRNTELGKPVQLLYKGTLRVLLVL
LHDFPEFLCDYHFGFCDTIPPNCVQMRNIILSAFPRNMRLPDPFTPNLKVDMLSDSSNAP
KVLSSYIMNIQPANFKKDLDSYLKARAPVTFLSELRGHLQVTSEPGTRYNMALMNALVMY
VGTQAIALIRNKNFVPNTSNIAHSAHMDIFQNLAVDLDTEGRYLFLNAIANQLRYPNSHT
HYFSCAVLHLFAEANSEAIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPIYKFWDHD
FVHCAPEITKYFGECLIVVKRFENSIGIQCAS
Download sequence
Identical sequences E2QCN4
NP_001163099.1.81976 FBpp0291332 FBpp0291332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]