SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2QUQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2QUQ1
Domain Number 1 Region: 17-149
Classification Level Classification E-value
Superfamily PH domain-like 5.21e-32
Family Pleckstrin-homology domain (PH domain) 0.000000478
Further Details:      
 
Domain Number 2 Region: 171-267
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000176
Family SH2 domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2QUQ1
Sequence length 293
Comment (tr|E2QUQ1|E2QUQ1_CANLF) Signal transducing adaptor family member 1 {ECO:0000313|Ensembl:ENSCAFP00000004064} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=STAP1 OC=Canis.
Sequence
MMAKKPPKPAPRRIFQERLKITSLPLYFEGFLLVKRSEYQEYKHYWTELRGTTLFFYSDK
KSPKYVDKLDIIDLTCLTDQNSTEKNCANFTLVLPKEEVQLKTENTESGEEWRGFILTVT
ELSVPLHMSLLPGQVIRLHEVLEREKKRRIETEQMPSSALGKEKEPVEDYVDVLSPMPVC
FYSVSRKEATEMLEKNPSLGNMILRPGSDSKSYSITIRQEIDLPRIKHYKVMSVGKNYTI
ELERPVTLPNLFSVIDYFMKETRGNLRPFIYSTDETLETKGFPATSLKLKKNV
Download sequence
Identical sequences E2QUQ1
ENSCAFP00000004064 ENSCAFP00000004064 9615.ENSCAFP00000004064 XP_005628306.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]