SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2QVS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2QVS1
Domain Number 1 Region: 193-287
Classification Level Classification E-value
Superfamily Cyclin-like 0.00000000000248
Family Cyclin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2QVS1
Sequence length 363
Comment (tr|E2QVS1|E2QVS1_CANLF) Cyclin Y like 1 {ECO:0000313|Ensembl:ENSCAFP00000019941} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=CCNYL1 OC=Canis.
Sequence
MGNTLTCCVSSNASPKLGRGTGPADPDYESDVYQAAAGDAVAVAPAPATVEPAELDFGAG
EGHHLQHISDREMPEDLALESNPSDHPRASTIFLSKSQTDVREKRKSNHLNHVSPGQLTK
KYSSCSTIFLDDSTVSQPNLRTTIKCVTLAIYYHIKNRDANRSLDIFDERSHPLTREKVP
EEYFKHDPEHKFIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPTNWKRIVLG
AILLASKVWDDQAVWNVDYCQILKDITVEDMNEMERHFLELLQFNINVPSSVYAKYYFDL
RSLADDNNVNFLFAPLSKERAQNLEAISRLCEDKYKDWSRAAMRRSFSADNFIGIQRSNA
ILS
Download sequence
Identical sequences E2QVS1
ENSCAFP00000019941 XP_005640648.1.84170 ENSCAFP00000019941 9615.ENSCAFP00000019941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]