SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2QWV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2QWV4
Domain Number 1 Region: 338-503
Classification Level Classification E-value
Superfamily PH domain-like 2.24e-35
Family Phosphotyrosine-binding domain (PTB) 0.0061
Further Details:      
 
Domain Number 2 Region: 526-657
Classification Level Classification E-value
Superfamily PH domain-like 7.79e-33
Family Phosphotyrosine-binding domain (PTB) 0.0000119
Further Details:      
 
Domain Number 3 Region: 243-284
Classification Level Classification E-value
Superfamily WW domain 0.000000000115
Family WW domain 0.0000682
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2QWV4
Sequence length 707
Comment (tr|E2QWV4|E2QWV4_CANLF) Amyloid beta precursor protein binding family B member 1 {ECO:0000313|Ensembl:ENSCAFP00000009615} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=APBB1 OC=Canis.
Sequence
MSVPSSLSQSAINANSHGGPALSLPLPLHTAHNQLLNSKLQATAVGPKDLRSAMGEGGGP
EPGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLMHLYSEL
ELSAHNAANRGLRGSGLIISTQEHGPDEGEEKAAGEAEEDDEEEDEEEEEEDLSSPQGLP
EPPESVEVPPRPQALADGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDT
DSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQGSSPQEESQL
TWTGFAHREGFEDGEFWKDEPSEEAPMDLGLKDTEEGALPFPAQSLSPEPLPQEEEKLPP
RNANPGIKCFAVRSLGWVEMTEEELAPGHSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGK
DLLLQLEDETLKLVEPQSQALLHAQPIVSIRVWGVGRDSGRDFAYVARDKLTQMLKCHVF
RCEAPAKNIATSLHEICSKIMAERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELVQK
FQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAATLTILHQQTEAVLGE
CRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLD
ARSQASTSCLPAPPAESVARRVGWTVRRGVQSLWGSLKPKRLGAHTP
Download sequence
Identical sequences E2QWV4
ENSCAFP00000009615 ENSCAFP00000009615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]