SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2QX58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2QX58
Domain Number 1 Region: 575-709
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-44
Family Phosphotyrosine-binding domain (PTB) 0.0000182
Further Details:      
 
Domain Number 2 Region: 418-560
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-21
Family SH2 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E2QX58
Sequence length 715
Comment (tr|E2QX58|E2QX58_CANLF) Tensin 4 {ECO:0000313|Ensembl:ENSCAFP00000023639} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=TNS4 OC=Canis.
Sequence
MSQVMSSPLLAGGHAVGLTPCEEPRRALHPAPSPSLPPQCPYYTTEGWGAQALMAPTPYK
GPPSRCQQGPQPGAKASCLLQSPGEQASGTLEDLDSYIDFSLESLNQMILELDPTFQLLP
SGAGSPWAEPTKNTTSRIKKDEPEALDIKYIEVTSTRSRCHDGPQCCSSPSVTPPFGSPR
SGGLLLSRDIPRETRSSSESLIFSGSQGRGHQRPPPSSGAPSSHPSPSPSISIPCMGNKA
SGPQGLGSPLAVSPGLEKGLGGLAPQRGSRVSVLSASPASDVSYVFGSSQSLLHSSMSSH
QSSSRSLESPASSSSSLHSLGQVSLCTRASDFQAPSNPTPNMGQPRATHSSPLAKEHASS
CPPSITNSMVDIPIVLINGYPEPGSPPSQQILGRQDFVRPGATSSSNSCPATRSHSQTLP
DAPLTTSSEGPTRDMQPTMKFVMDTSKYWFKPSITREQAIELLRKEEPGAFVVRDSSSYR
GSFGLALKVQEAPAPSPNRSGEDNSDLIRHFLIESSAKGVHLKGADEEPYFGSLSAFVCQ
HSIMALALPCKLTIPQKGRSGPQKGNTRALGLSILTRKAPSCHALYLTSVSVESLSGALA
VRKAISTTFERDVLPTPTVVHFKVTEQGITLTDVQRKVFFRRHYPLATLRFCGMDPEQRK
WQKYCKPSWIFGFVAKSQTESQENVCHLFAEYDTVQPASQVISLVGTLLQDTERM
Download sequence
Identical sequences E2QX58
ENSCAFP00000023639 ENSCAFP00000023639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]