SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2QYI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2QYI2
Domain Number 1 Region: 3-131
Classification Level Classification E-value
Superfamily PH domain-like 5.78e-56
Family Necap1 N-terminal domain-like 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2QYI2
Sequence length 275
Comment (tr|E2QYI2|E2QYI2_CANLF) NECAP endocytosis associated 2 {ECO:0000313|Ensembl:ENSCAFP00000023387} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=NECAP2 OC=Canis.
Sequence
MEEGEYESVLCVKPEVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQVAYIKLE
DRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNV
ALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGTPRARPA
STGGLSLLPPPPGGKTSTLIPPPGEQLSGGAPVVQTAVAPSSGRLPVRLNQAQAGSSSDL
SIPFFFLITISGKEPPHLGQRKEDEALPGQLLFGA
Download sequence
Identical sequences E2QYI2
ENSCAFP00000023390 XP_005618007.1.84170 ENSCAFP00000023387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]