SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2QYZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2QYZ5
Domain Number 1 Region: 165-287
Classification Level Classification E-value
Superfamily Cyclin-like 2.64e-39
Family Cyclin 0.000000588
Further Details:      
 
Domain Number 2 Region: 11-164
Classification Level Classification E-value
Superfamily Cyclin-like 4.12e-30
Family Cyclin 0.000000878
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2QYZ5
Sequence length 326
Comment (tr|E2QYZ5|E2QYZ5_CANLF) Cyclin H {ECO:0000313|Ensembl:ENSCAFP00000012312} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=CCNH OC=Canis.
Sequence
MYHNSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKYIIVLKLFYEPSRYFVTLVDF
YLSLCDLMTEKGMLKPSQPTLVLGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDE
FNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTR
YPMMENPEMLRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLM
LKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAALKQKLERCHSAELALNVITKKRKGY
EDDDYVSKKPKHEEEEWTDDDLVDSL
Download sequence
Identical sequences E2QYZ5
ENSCAFP00000012312 ENSCAFP00000031379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]