SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2R037 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2R037
Domain Number 1 Region: 1125-1301
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.47e-40
Family BCR-homology GTPase activation domain (BH-domain) 0.0006
Further Details:      
 
Domain Number 2 Region: 687-802
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.15e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0014
Further Details:      
 
Domain Number 3 Region: 453-574
Classification Level Classification E-value
Superfamily PH domain-like 3.67e-25
Family Pleckstrin-homology domain (PH domain) 0.0000126
Further Details:      
 
Domain Number 4 Region: 881-1040
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-22
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 5 Region: 1435-1539
Classification Level Classification E-value
Superfamily PH domain-like 1e-17
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Domain Number 6 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.3e-16
Family SAM (sterile alpha motif) domain 0.0000442
Further Details:      
 
Domain Number 7 Region: 584-680
Classification Level Classification E-value
Superfamily PH domain-like 6.04e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 8 Region: 1017-1111
Classification Level Classification E-value
Superfamily PH domain-like 0.00000019
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E2R037
Sequence length 1700
Comment (tr|E2R037|E2R037_CANLF) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 {ECO:0000313|Ensembl:ENSCAFP00000024024} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=ARAP2 OC=Canis.
Sequence
MSSVSEVNVDIRDFLMSINLEQYLLHFRKFGFNTVKDCAAINDGVLHKIGISPTGHRRRI
LKQLQMILSKMQDIPIYANIHKTKKDDETSEDHHAPSSGQNTSIELSDTGGVQAPSPTQW
ETVIKNLDRNDVSVENSQSLKSDDKLSLLKHNFPIPEEEPHLNLSSFQHTLFGNENIKIE
SLITEKTTDCTSEEQQTIRFDLLSENASKHPDADPECLSSLGCSDSEANSGSGTNGLIER
SPPSPFFQFQGEMVVNDLYVPSSPILAPMRSRSKLVSRPSRSFLLRHRPVPEIPASTKGI
SGSYYRERRNVATSTGKSVTQENSNEENSSSIFPYGETFLFQRLENSKKRSIRNEFWTDE
ETLKGDTINERNSFLIKSSIYDNKKENISEDKVEDIWIPREDKNNFPRDSASESEYSTVE
ECFQSLRRKNSKASKARTQKALTVDPVNRHSYPLSSTSGNAESTVVSSNAISPYACFYGF
SARKVKSGWLDKLSPQGKRMFQKRWVKFDGLSISYYNNEKEKYSKGIIPLSAISTVRVQG
DNKFEVVTTQRTFVFRVEKEEERNDWISILLNALKSQSPASQSQAAPVPEKCGYLELRGY
KAKIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSF
TAESEKEKQEWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVI
CKKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHM
DSPVEKRKNFITQKYKEGRFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVM
CATGDPVYSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGGLSQESSQSTFLCDFL
YQAPSAASKLSSEKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTINISEVICLAVHKE
DFYLNTGPIFTFEIYLPSERAFLFGAETSQAQRKWTEAIAKHFVPFVAENLTEADYDLIG
QLYYKDCHALDQWRKGWFSMEKSSLRFCLQMQEVQEDRMHLRRLQELTISTVVQNGEKMD
ILLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFV
TQYGLGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTGVLKNFLSDIDDA
LLTKELYPYWISALDTQEDKERIKKYGAFIRTLPGVNRATLAAVIEHLYRVQKCSEINHM
NAHNLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKD
TQVSQAGDLLIEVYVEKKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKGDIWATFEV
IENEELERPLHYTENVLEQVLRWSSLAEPGSAYLVVKRFLTIDTIKHYNERRTLESIKEG
VLKIKEEPSKILSGNKFQDRYFVLRDGYLFLYKDSKSSKYDKMFSLASMKFYLGVKKKMK
PPTSWGLTAYSEKHHWHICCDSLQTQMEWMANVFIAQEDCCLWDIRKGRENINNLTKNPG
LGGLPLIPIQHERSATLARRNIENARAELERLQLSEKRDQELGDSSIKERASMVAHCLEH
KDEKLRTRTRKHRSFNCLEDTEAEVLPGPQKSHKGLKTLRKTEDRNGRAALDSDSKLPSR
VIEELSVVLQRTRTFPKDSQ
Download sequence
Identical sequences E2R037
ENSCAFP00000024024 ENSCAFP00000024024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]