SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2R079 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2R079
Domain Number 1 Region: 3-64,97-412
Classification Level Classification E-value
Superfamily Serpins 3.27e-128
Family Serpins 0.0000000000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2R079
Sequence length 416
Comment (tr|E2R079|E2R079_CANLF) Serpin family B member 2 {ECO:0000313|Ensembl:ENSCAFP00000000067} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=SERPINB2 OC=Canis.
Sequence
MEELYVANTIFALNIFKHLANTTATPNLFFSPWSISSTIAMVYLGARGKTADQMAKVFQF
DKIGAPETPVTPENLTGCELMQQIQKSPYPEAISQAQAGAALHSAFSSLSAAVSAASGEY
LLESVNQLFGEKTARFKEEYMRLSKKYYSTEPQAVDFLECAEETRKKINSWVKTQTKGKI
PDLLPKGSVDGDTKMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNTTQRVPVQMMYLHADL
NIGYIGDLKTQILELPYAGNISMFLLLPDEITDVSTGLELLESEITYDKFIKWTSKDTMA
EDNVEVYLPQFKLEERYELRSILRNMGMEEAFSQSQANFSGMSNTNDLFLSQVFHQATVD
VNEEGTEAAAGTGATLSGRTGHGGPQFVADHPFLFLIMHKITKSILFFGRLVLPQN
Download sequence
Identical sequences E2R079
XP_851985.2.84170 ENSCAFP00000000067 ENSCAFP00000000067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]