SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2R1E5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2R1E5
Domain Number 1 Region: 18-146
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-23
Family Pleckstrin-homology domain (PH domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 147-238
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000996
Family SH2 domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2R1E5
Sequence length 411
Comment (tr|E2R1E5|E2R1E5_CANLF) Signal transducing adaptor family member 2 {ECO:0000313|Ensembl:ENSCAFP00000028171} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=STAP2 OC=Canis.
Sequence
MASALSPPRGPKGKGALPSHYYESFLEKKGPHDQDYKKFWAGLQGCTLYFYNSNRDSQHV
EKLGLGAFVRLSDEAPGGSPRDPGIYFSLVLWNQEIKFKVESLESREMWKGFILTVVELR
VPSNLTLLPGHLYMMAEALAKEEARRALEVPPCFLRVSRLEAQLLLERYPECGNLLLRPS
GDGADDVSVTTRQTLHGTPVFRHYKVKRDGSKYVIDVEDPLSCASLDAVVNYFVSNTNRR
LVPFRLDEDYEKVLGHVEADKENGESVWVASSAPVAPGPGPAPASGGCKQLPPVPITPPP
SQDKPPLLLNQNENYVIPIADAPAADYENEDVPSPSWQVVPKPRKLAKSLKPPIAPKPEP
KGVNSGLAKKLAVGSVQALFPTTGLADLTAELEEKLQRRRALEHSAGCAGE
Download sequence
Identical sequences E2R1E5
ENSCAFP00000028171 ENSCAFP00000028171 XP_542159.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]