SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2R245 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2R245
Domain Number 1 Region: 71-166
Classification Level Classification E-value
Superfamily Cyclin-like 1.25e-16
Family Transcription factor IIB (TFIIB), core domain 0.023
Further Details:      
 
Domain Number 2 Region: 6-42
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000935
Family Transcriptional factor domain 0.015
Further Details:      
 
Weak hits

Sequence:  E2R245
Domain Number - Region: 199-256
Classification Level Classification E-value
Superfamily Cyclin-like 0.000893
Family Transcription factor IIB (TFIIB), core domain 0.024
Further Details:      
 
Domain Number - Region: 363-412
Classification Level Classification E-value
Superfamily Stathmin 0.0366
Family Stathmin 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2R245
Sequence length 421
Comment (tr|E2R245|E2R245_CANLF) BRF2, RNA polymerase III transcription initiation factor subunit {ECO:0000313|Ensembl:ENSCAFP00000009282} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=BRF2 OC=Canis.
Sequence
MPGGGRCPDCGSAELVDDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTG
ENEQVSRSQQRGLRRVRDLCRVLQLPSTFEDTAVAYYQQAYRHSGIRAARLQKKEVLVGC
CVLITCRQHNWPLTMGTICALLYADLEVFSGTYMQIVKLLGLDVPSLCLADLVKTYCSSF
KLFQASPSVPAKYVEDKEKMLSRTLQLVELADETWLVTGRHPLPVITAATFLAWQSLQPS
ERLTCSLARFCKLANVDLPCPASSRLQELLAVLLRMAEQLAWLQVLRLDKRSVVKHIGDL
LQHRHTLVRKAFRDGTAELEAGEKQQQGWGKSPGQGKEEAATSSLDRPEGKRPASPALLL
PPCMLKPPKRICPPPPISTVTGDEDISDSEIEQYLRTPQEVRDFQKAQAARQAAIGVSNP
P
Download sequence
Identical sequences E2R245
9615.ENSCAFP00000009282 ENSCAFP00000009282 ENSCAFP00000009282 XP_850010.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]