SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2R2R3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2R2R3
Domain Number 1 Region: 6-121
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.41e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.0021
Further Details:      
 
Domain Number 2 Region: 248-357
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-23
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 3 Region: 121-229
Classification Level Classification E-value
Superfamily PH domain-like 1.45e-17
Family Pleckstrin-homology domain (PH domain) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2R2R3
Sequence length 374
Comment (tr|E2R2R3|E2R2R3_CANLF) ArfGAP with dual PH domains 1 {ECO:0000313|Ensembl:ENSCAFP00000016695} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=ADAP1 OC=Canis.
Sequence
MAKERRRAVLELLQRPGNARCADCGAPDPDWASYTLGVFICLSCSGIHRNIPQVSKVKSV
RLDAWEEAQVEFMASHGNDVARDTYESKVPPFYYRPTFSDCQLLREQWIRAKYERQEFTH
PDKQEPYSAGYREGFLWKRGRDNGQFLSRKFVLTEREGSLKYFNRNDAKEPKAVMKIEHL
NATFQPAKIGHPHGLQVTYLKDNSTRNIFVYHEDGKEIVDWFNALRAARFHYLQVAFPGA
SDADLVPKLSRNYLKEGYMEKTGPKQTEGFGKRWFTMDDRRLMYFKDPLDAFARGEVFIG
SRESGYTVLDGLPPSTQGHHWPHGITIVTPERRFLLACETETEQRAWVEAFRKVVDRPML
PQEYAVEAHFKHKP
Download sequence
Identical sequences E2R2R3
9615.ENSCAFP00000016695 XP_848516.1.84170 ENSCAFP00000016695 ENSCAFP00000016695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]