SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2R996 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2R996
Domain Number 1 Region: 5-143
Classification Level Classification E-value
Superfamily Cyclin-like 7.23e-27
Family Cyclin 0.0024
Further Details:      
 
Domain Number 2 Region: 146-241
Classification Level Classification E-value
Superfamily Cyclin-like 0.000000000068
Family Cyclin 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2R996
Sequence length 372
Comment (tr|E2R996|E2R996_CANLF) Cyclin J {ECO:0000313|Ensembl:ENSCAFP00000012414} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=CCNJ OC=Canis.
Sequence
MELEGQWWRGQLAADIHQALRYKELKLPSYKGQSPQLSLRRYFADLIAIVSNRFTLCPSA
RHLAVYLLDLFMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL
VLTKQNLLHMELLLLETFQWNLCLPTAAHFIEYYLSEAVHETDLHDGWPMICLEKTKLYM
AKYADYFLEVSLQVAAACVASSRIILRLSPTWPTRLHRLTAYSWDFLVQCIERLLIAHDN
DVKEANKQRGQAGSQPAQLSVLQSASQPSRPVHFQQPHYLHQTHHTSLQYRHPVAEQPSC
QQIGSTTHTSSYTLQTCPAGFQTSVQGLGHVQTGVGMSLAIPVEVKPCLNVSYNRSYQIN
EHYPCITPCFER
Download sequence
Identical sequences E2R996
ENSCAFP00000012414 ENSCAFP00000040080 XP_005637626.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]