SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2R9S0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2R9S0
Domain Number 1 Region: 126-374
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.05e-69
Family Nuclear receptor ligand-binding domain 0.00000000136
Further Details:      
 
Domain Number 2 Region: 57-140
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-30
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E2R9S0
Sequence length 474
Comment (tr|E2R9S0|E2R9S0_CANLF) Hepatocyte nuclear factor 4 alpha {ECO:0000313|Ensembl:ENSCAFP00000013863} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=HNF4A OC=Canis.
Sequence
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGANLNAPNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC
FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSQQITSPVSGINGDIRAKK
IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK
DVLLLGNDYIVPRHCPELAEMSRVSMRILDELVLPFQELQIDDNEYACLKAIIFFDPDAK
GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL
FGMAKIDNLLQEMLLGGSSSDAPHAHHPLHPHLMQEHMGTNVIVANTMPSHLSNGQMCEW
PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAIATIVKPPSAIPQPTITKQEVI
Download sequence
Identical sequences E2R9S0
9615.ENSCAFP00000013863 ENSCAFP00000013863 XP_852731.1.84170 ENSCAFP00000013863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]