SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2R9U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2R9U9
Domain Number 1 Region: 542-754
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.41e-47
Family DBL homology domain (DH-domain) 0.00053
Further Details:      
 
Domain Number 2 Region: 234-378
Classification Level Classification E-value
Superfamily PH domain-like 2.8e-43
Family Third domain of FERM 0.00051
Further Details:      
 
Domain Number 3 Region: 882-1032
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-32
Family Pleckstrin-homology domain (PH domain) 0.002
Further Details:      
 
Domain Number 4 Region: 739-862
Classification Level Classification E-value
Superfamily PH domain-like 3.34e-29
Family Pleckstrin-homology domain (PH domain) 0.0056
Further Details:      
 
Domain Number 5 Region: 133-233
Classification Level Classification E-value
Superfamily Second domain of FERM 2.36e-28
Family Second domain of FERM 0.00012
Further Details:      
 
Domain Number 6 Region: 52-133
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.12e-20
Family First domain of FERM 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E2R9U9
Sequence length 1038
Comment (tr|E2R9U9|E2R9U9_CANLF) FERM, ARH/RhoGEF and pleckstrin domain protein 2 {ECO:0000313|Ensembl:ENSCAFP00000019154} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=FARP2 OC=Canis.
Sequence
MGEIEGTYRVLQTPGTRLGAQTLAGVSTLEPGQTLSGAATRASAKMQEKHLHIRVKLLDN
TVEIFDVEPKRDGQALLTQVWRHLNLTECDYFGLELQHPRSYWIWLEPMKPIIRQVRRPK
NTLLRLAVKFFPPDPGQLQEKYFRYLFALQLKRDLLEERLPCADTTAALLASHLLQSEIG
DYDETLDREHLKANEYLPSQERFLEKILEFHRKHTGQTPAESDFQVLEIARKLEMYGIRF
HPASDREGARINLAVSHMGVLVFQGTTKINTFNWSRVRKLSFKRKRFLIKLHPEVRGPYQ
DTLEFLLGSRDECKNFWKICVEYHTFFRLFDQPKAKAKAVFFSRGSSFRYSGRTQKQLVD
YVRDSGVKRVPYERRHSKTRASLRALTADLPRQSISFTEGMRTSASPASTNASFYSVPTS
PLAPRGPCDFKDSSGSLTEPQAPDAKRPAAERSGGAAADGDARRAQSPGPPAPQPCQGLS
AESPQPSPSTRKSPPSLSPASRVTLGLTGQGSSPLLSPALSDAGGVRTDGEEEPRHKGPA
ADEAYFIAKEMLATERTYLKDLEVLTVWFRSAVVREDAMPADLMTLLFSNIDPIYEFHRR
FLREVEQRLALWEGSSNTHATAGHQRIGDILLRNMHQLKDFTSCFQRHDEVLSELEKAAR
RGGKLAAACRAFELQRVCYLPLNAFLLKPVQRLLHYRLLLSRLCGLYAPAHPDSADCRDA
LQAITEVTSALQHSLARLENLQKLTELQRDLVGVDNLVTPGREFIREGCLHKLTKKGLQQ
RMFFLFSDVLLYTSRGVTGTSRFRIRGRLPLRGMLVEEGERERSVPHCFTICAAQKTIVV
AASTRLEKEKWMRDLNDAIDMAKRGSDLSLVLPGSVLCAPPYRSSEEASLEQEAEEAGGP
HGSLEGQGQRRANTTVHVCWYRNTSVSRADHSAAVENQLSGYLLRKFKNSSGWQKLWVVF
TNFCLFFYKTHQDDHPLASLPLLGYSVSVPEEADGVHKEHVFKLQFKSHVYFFRAESKYT
FERWMEVIERASSSPARA
Download sequence
Identical sequences E2R9U9
ENSCAFP00000037916 ENSCAFP00000019154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]