SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RA33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RA33
Domain Number 1 Region: 1199-1413
Classification Level Classification E-value
Superfamily VPS9 domain 4.71e-52
Family VPS9 domain 0.00014
Further Details:      
 
Domain Number 2 Region: 95-467
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-47
Family p120GAP domain-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2RA33
Sequence length 1416
Comment (tr|E2RA33|E2RA33_CANLF) GTPase activating protein and VPS9 domains 1 {ECO:0000313|Ensembl:ENSCAFP00000029938} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=GAPVD1 OC=Canis.
Sequence
MVKLDIHTLAHHLKQERLYVNSEKQLIQRLNADVLKTAEKLYRTAWIAKQQRINLDRLII
TSAEASPAECCQHAKILEDTQFVDGYKQLGFQETAYGEFLSRLRENPRLIASSLVAGEKL
NQENTQNVIYTVFTSLYGNCIMQEDESYLLQVLRYLIEFELKESDNPRRLLRRGTCAFSI
LFKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIDRFSPLQQEKLFGEKGS
DRFRQKVQEMVDSNEAKLVALVNKFIGYLKQNTYCFPHSLRWIVSQMYKTLSCVDRLEVG
EVRAMCTDLLLACFICPAVVNPEQYGIISDAPINEVARFNLMQVGRLLQQLAMTGSEEGD
PRTKSSLGKFDKSCVAAFLDVVIGGRAVETPPMSSVNLLEGLSRTVVYITYSQLITLVNF
MKSVMSGDQLREDRMALDNLLANLPQAKPGKSSSLEMTPYNTPQLSPATTPANKKNRLPI
ATRSRSRTNVLMDLHMEHEGSSQETIQEVQPEEVLVISLGTGPQLTPGMMSENEVLNMQL
SDGGQGDVPVDENKLHGPSNRSNSVSSLDLEGESVSELGAGPSGSNGVEALQLLEHEQAT
TQDNLDDKLRKFEIRDMMGLTDDRDISETVSETWSTDVLGSDFDPNIDEDRLQEIAGAAA
ENMLGSLLCLPGSGSVLLDPCTGSTISETTSEAWSVEVLPSDSEAPDLKQEERLQELESC
SGLGSTSDDTDVREVSSRPSTPGLSVVSGISATSEDIPNKIEDLRSECSSDFGGKDSVTS
PDMDEVTHGAHQLTSPPSQSESLLAMFDPLSSHEGVLGASAVVRPKVHYARPSHPPPDPP
ILEGAVGGNEARLPNFGSHVLTPAEMEAFKQRHSYPERLVRSRSSDIVSSVRRPMSDPSW
NRRPGNEERELPPAAAIGATSLVAAPHSSSSSPSKDSSRGETEERKDSDDEKSDRNRPWW
RKRFVSAMPKDDPSPRLSAQAQVAEDILDKYRNAIKRTSPSEGAMANYESAEVMGDGESA
HDSPREETLQNISADDLPDSASQAAHPQDSAFSYRDAKKKLRLALCSADSVAFPVLTHST
RNGLPDHTDPEDNEIVCFLKVQIAEAINLQDKNLMAQLQETMRCVCRFDNRTCRKLLASI
AEDYRKRAPYIAYLTRCRQGLQTTQAHLERLLQRVLRDKEVANRYFTTVCVRLLLESKEK
KIREFIHGDFQQLTAADDKTAQVEDFLQFLYGAMAQDVIWQNASEEQLQDAQLAIERSVM
NRIFKLAFYPNQDGDILRDQVLHEHIQRLSKVVTANHRALQIPEVYLREAPWPSAQSEIR
TISAYKTPRDKVQCILRMCSTIMNLLSLANEDSVPGADDFVPVLVFVLIKANPPCLLSTV
QYISSFYASCLSGEESYWWMQFTAAVEFIKTIDDRK
Download sequence
Identical sequences E2RA33
ENSCAFP00000029938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]