SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RE11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RE11
Domain Number 1 Region: 95-272
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.08e-63
Family F-box associated region, FBA 0.0000212
Further Details:      
 
Domain Number 2 Region: 8-48
Classification Level Classification E-value
Superfamily F-box domain 0.00000262
Family F-box domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2RE11
Sequence length 276
Comment (tr|E2RE11|E2RE11_CANLF) F-box protein 17 {ECO:0000313|Ensembl:ENSCAFP00000008388} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=FBXO17 OC=Canis.
Sequence
MGARPSRRQLPAEPPLALDALPPELLVQVLGHVPPRALVTRCAPVCRACADVDGPTVGLA
ELARDRSAEGRALYAVAQRCPPHGEDEEFPLCALARYCLRAPLGRNLIFNSCGEQGFRGW
EVEHGGNGWAVEKNLTLVPGAPSQTCFVTSFQWCFKRQLVDLVMEGVWQELLDSAQIEIC
VADWWGARENCGCIYRLRVRLLDTYENEVVKFSASPNPVLQWTERGCRQVSHVFTNFGKG
IRYVSFEQYGRDTRSWVGHYGALVTHSSVRVRIRLS
Download sequence
Identical sequences E2RE11
ENSCAFP00000037266 ENSCAFP00000008388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]