SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RE33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RE33
Domain Number 1 Region: 11-143
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 7.32e-24
Family CSE2-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E2RE33
Sequence length 147
Comment (tr|E2RE33|E2RE33_CANLF) Mediator complex subunit 9 {ECO:0000256|RuleBase:RU364145} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=MED9 OC=Canis.
Sequence
MASAGVAAGRQAEDALPPPAEPSLPETKPLPPSQPPPPVAVPQPQQSPATRPQSPAGVKE
EENYSFLPLVHNIIKCMDKDSPDIHQDLNALKTKFQEMRKVISSMPGIHLSPEQQQQQLQ
SLREQVRTKNELLQKYKSLCMFEIPKE
Download sequence
Identical sequences E2RE33
ENSCAFP00000027247 ENSCAFP00000027247 9615.ENSCAFP00000027247 XP_851901.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]