SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2REI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2REI3
Domain Number 1 Region: 493-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000635
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 2 Region: 95-145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000001
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 725-780
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000417
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 543-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000321
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 633-661
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000127
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 586-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000414
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Domain Number 7 Region: 788-812
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000892
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Weak hits

Sequence:  E2REI3
Domain Number - Region: 153-184
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00585
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number - Region: 193-321
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 0.0765
Family Galactoside acetyltransferase-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2REI3
Sequence length 896
Comment (tr|E2REI3|E2REI3_CANLF) Zinc finger protein 512B {ECO:0000313|Ensembl:ENSCAFP00000019341} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=ZNF512B OC=Canis.
Sequence
GLSGPGRPAPSFAEMTDPFCVGGGRRLPGSTKSGPGKDGGRNEVRLPVLHDPPKLGMPVV
RGGPTVPSQAALCFDPGSPASDRTEGKKKGRPKAENQALRDIPLSLMNQWKDEFKAHSRV
KCPNSGCWLEFPSIYGLKYHYQRCQGGAIPERLTFPCPFCEAAFTSKTQLEKHRIWNHMD
RPVPAPKPGPVSRPVTISRPVGVSKPIGVSKPVTIGKPVGVSKPIGISKPVTVSRPVPVT
KPVPVSRPVPVTKAVTVSRPVPVTKPIPVTKSVPVTKPVPVTKPVTLNKPVPVTKKPVTV
SRPIVVSKPVTVSRPIAISRHTPPCKMVLLTKSENKTPRTTGRSSGKKRAADSLDTCPIL
PKQARPENGEYGSSTTGHSSAFQLSADPGGSPLSLGSRPLGSKEGLRATGPVSPPDEGAE
RIKHRRKQKTPKKFTGEQPSISGTFGLKGLAKAEDKSRMHRAKKPEGPGPEDVRKKVLAP
ASTVSKEAPAPAAHTAPGGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCQKL
QDALKCQHCRKQFKSKAGLNYHTMAEHSAKPSDAEASEGSEQEERERLRKVLKQMGRLRC
PQEGCGAAFSSLMGYQYHQRRCGKPPCEVDSPSFPCTHCGKTYRSKAGHDYHMRSEHTAP
PPEEPEDKPPETEDLLGVERTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRVKDDLV
PETARLNYTRPGLPTLNPQLLEAWKNEVKEKGHVNCPNDCCEAIYSSVSGLKAHLASCSK
GDHLVGKYCCLLCPKEFSSESGVKYHILKTHAENWFRTSADPLPKHRSQDSLAPKKEEKK
SLAGGKKRGRKPKERTPEEPAPKMPPRRDDWPPGGRDKGARGSTGRKAGASKAPEK
Download sequence
Identical sequences E2REI3
ENSCAFP00000019341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]