SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2REP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2REP7
Domain Number 1 Region: 42-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.88e-34
Family SCAN domain 0.0000974
Further Details:      
 
Domain Number 2 Region: 786-842
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 842-898
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 883-935
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-16
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 5 Region: 738-786
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000206
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 225-285
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000379
Family KRAB domain (Kruppel-associated box) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2REP7
Sequence length 969
Comment (tr|E2REP7|E2REP7_CANLF) Zinc finger with KRAB and SCAN domains 2 {ECO:0000313|Ensembl:ENSCAFP00000025754} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=ZKSCAN2 OC=Canis.
Sequence
MAASLDPQIDVPLEVEGCLIMKVEKEPEWAVEPSLEASEGSESETFRRCFRQFCYEDVAG
PHEAFSKLWELCCRWLKPEVRSKEQILELLVIEQFLTILPKKIQAWAQKQCPESGEEAVA
LVIHLEKEAGRLRQQVNSPVHSEKQAPLGAAWEVTDFQPEQVETTGVVSLEEAGSLHSGH
KEQLNRKREHRPLPKNAQPSPWVPAPAHEWNSMDQEVTTTRQPVVSQGPVKDVHMARGFS
YKKSVHQIPAHRDLYRDIRKESVGNMVSLGSTASASSKIARLEQRKEPWTLGLHSSNKRN
IILRSNHIKEKPVHATQIPARSAGRVWGEQQHWGLEDEKIAGVHWSYEETKTFLAILKES
RFYETLQACPRNSQVYGAVAEWLRECGFLRTPEQCRTKFKSLQKSYRKVRNGHVLEPCAF
FEDMDALLNPAAHASSADKPKEILSLPRLKRVDISAKEQINLVEEEDAAEESDGDEIGIE
FIRKSEIRGAPVLFQNLSGVHWGYEETKTFLDILRETRFYEALQACHRKSKLYGAVAEQL
RECGFLRTPEQCRTKFKSLQKSYRKVKNGHVLESCAFYKEMDALINSRASAPSTNTPEEV
PSPSGQEGEDIEIEPQEPIGWEPEEASQEAMAEDSGSERMSEEEIVQESAFQGPPGLLPS
PSDFEIGGSFKEDTTQVIYKDMEQHRALIEKSKRVISQNADPGKYCKREYISGRQWENLQ
GIRQGKLMSQPRDLGKAVVHTRPFMGKRPYRLLKYGESFGRNARLMCRMTHQKENPYKCS
VCGKCFGRSRSLIRHQRIHTGEKPFKCLDCGKSFNDSSNFGAHQRIHTGEKPYRCGECGK
CFSQSSSLIIHQRTHTGEKPYQCGECGKSFTNSSHFSAHRRVHTGENPYKCVDCEKSFNN
CTRFREHRRIHTGEKPYGCAQCGKRFSKSSVLTKHREVHSREKLLPHPPSSCSPENPPKG
KTDEFRKTF
Download sequence
Identical sequences E2REP7
XP_003639146.1.84170 ENSCAFP00000025754 ENSCAFP00000025754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]