SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RES2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RES2
Domain Number 1 Region: 49-462
Classification Level Classification E-value
Superfamily Serpins 3.27e-137
Family Serpins 0.000000000000717
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2RES2
Sequence length 465
Comment (tr|E2RES2|E2RES2_CANLF) Serpin family C member 1 {ECO:0000313|Ensembl:ENSCAFP00000021382} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=SERPINC1 OC=Canis.
Sequence
MFSNGIGMIAAGKRRTCLLSLLLIGLWGCVVCPWSPGEDICTAKPRDIPVNPMCIYRSPE
KKAVEDEGAEQKIPEATNRRVWELSRANSRFATAFYQHVADSKNDNDNIFLSPLSISTAF
AMTKLGACNNTLKQLMEVFKFDTISEKTSDQVHFFFAKLNCRLYRKANKSSELVSANRLF
GDKSLTFNETYQDISEAVYGAKLQPLDFKENAEQSRMIINKWVSNKTHGRITDVVPPDAI
DELTVLVLVNTIYFKGLWKSKFSPENTRKELFYKAGGESCSVSMMYQEGKFRYRRVAEGT
QVLELPFKGDDITMVLILPKPEKSLAKVEQELTPEVLQEWLDEMTETLLVVHMPCFRMED
SFSVKERLQDMGLVDLFNPEKSRLPGIVAEGRNDLFVSDAFHKAFLEVNEEGSEAAASTV
IGIAGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCDN
Download sequence
Identical sequences E2RES2
ENSCAFP00000021382 XP_537187.4.84170 ENSCAFP00000021382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]