SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RFK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RFK8
Domain Number 1 Region: 542-643
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-23
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 
Weak hits

Sequence:  E2RFK8
Domain Number - Region: 222-327,542-562
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0502
Family BAR domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E2RFK8
Sequence length 648
Comment (tr|E2RFK8|E2RFK8_CANLF) Pleckstrin homology like domain family B member 3 {ECO:0000313|Ensembl:ENSCAFP00000007093} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=PHLDB3 OC=Canis.
Sequence
MGTPSGPEEGGQPPPVSEGDAEARPQGAAQPHVHPEDPHEPEAPAAPEEPQPVKELPSGR
GAEQQAEEEEEVGEGSSTESSRDAGEAPPPARTPATPPASSPPGEGVRGAARRLREQQLE
ALTRVALMEQRVKELQRQRKELRIEMEVEVALLRGELAGERVAARREEEQLRELLGQQVD
TEQGSHEQREQEQRQLIQERDRVEGLRQRLQEAQGQLDSQPEDQRERLLQGVQEMREQLD
AAQRAYEDLEFQQLEQESRREEEDQDSPGARAGDPKVRELQASVAQHRRRIQVLEEQLKS
LGEQMAAESRGLSQKKEEALQALTQERNRLLELNCLQRTPGRNFSESSQALTKLLITQKT
DRQLLVYQDPTAHTASTTSSCLFSVHSSLQGSIGLQRTGSLPRKRGERASQRGSPRPLSL
HCTGPLGASALPPASGDSGRHPLYQLLNCGPGNSCGSLHPDIARMEQLLQQAVAERERLL
KAREGLRRSKEGSSGPAVPALMAPPSPPPRPPGPRVLDLRQHLERWGHSPESCPHVRVSG
GCCRGSLVKMGGRIKTWKKRWFCFDRQARRLAYYADKEETKLKGVIYFQAIEEVYYDHLR
CAFKSPNPRLTFCVKTYERLFYMVAPSPEAMRIWMDVVVTAADENHAP
Download sequence
Identical sequences E2RFK8
XP_005616554.1.84170 ENSCAFP00000007093 ENSCAFP00000007093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]