SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RFX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RFX3
Domain Number 1 Region: 65-196
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.09e-26
Family Cytidylyltransferase 0.0058
Further Details:      
 
Weak hits

Sequence:  E2RFX3
Domain Number - Region: 194-264
Classification Level Classification E-value
Superfamily Outer surface protein C (OspC) 0.00157
Family Outer surface protein C (OspC) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2RFX3
Sequence length 357
Comment (tr|E2RFX3|E2RFX3_CANLF) Phosphate cytidylyltransferase 1, choline, beta {ECO:0000313|Ensembl:ENSCAFP00000019864} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=PCYT1B OC=Canis.
Sequence
EVGHSPCSNVWIILQSSSQGPPVLRETLTAPAPFADETSCQCQAPHEKLTIAQARLGTPV
DRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERY
EALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVP
TQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKKYRFQNQVDKMKEKV
KNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWWKQMFQERSSRMLQ
ALSPKQSPVSSPTRSRSPSRSPSPTFSWLPNKASPPSSPKAASASISSMSEGDEDEK
Download sequence
Identical sequences E2RFX3
ENSCAFP00000034086 ENSCAFP00000019864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]