SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RG20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RG20
Domain Number 1 Region: 6-229
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 9.81e-44
Family Galactose oxidase, central domain 0.0052
Further Details:      
 
Domain Number 2 Region: 243-344
Classification Level Classification E-value
Superfamily Kelch motif 4.97e-18
Family Kelch motif 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2RG20
Sequence length 350
Comment (tr|E2RG20|E2RG20_CANLF) Kelch domain containing 8A {ECO:0000313|Ensembl:ENSCAFP00000014777} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=KLHDC8A OC=Canis.
Sequence
MELPSVKDFQWKRLAPLPSRRVYCSLLESGGQVYAIGGCDDSGVPVDCFEVYSPEADRWT
ALPRLPTARAGVAATALGKRIMVIGGVGTSQLPLKVVEMYNIDEGKWKRRSVLREAAMGI
SVTAKDYRVYAAGGMGLDLRPHNHLQHYDMLKDMWVSLAPMPTPRYAATSFLRGSKIYVL
GGRQSKYAVNAFEVFDIETRSWTKFPNIPCKRAFSSFVTLDDRLYSLGGLRQARLYRQPK
FLRTMDVFDMEQGGWLKMERSFFLKKRRADFVAGSLSGRVIVAGGLGNQPTVLETAEAFH
PGKNKWEVLPPMPTPRCACSSIVIKNCLLAVGGVNQGLSDTVEALCVSDS
Download sequence
Identical sequences E2RG20
XP_545688.1.84170 ENSCAFP00000014777 ENSCAFP00000014777 9615.ENSCAFP00000014777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]