SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RGF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RGF8
Domain Number 1 Region: 113-299
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.87e-74
Family F-box associated region, FBA 0.0000000174
Further Details:      
 
Domain Number 2 Region: 47-143
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000523
Family F-box domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2RGF8
Sequence length 299
Comment (tr|E2RGF8|E2RGF8_CANLF) F-box protein 2 {ECO:0000313|Ensembl:ENSCAFP00000006864} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=FBXO2 OC=Canis.
Sequence
MDGDGEPESVSQPEEEVSPEGQPEEAEAASGGEERPEAEAEAEAGAAAHLDELPEPLLLR
VLAELPAAQLVQACRLVCLRWKELVDGGPLWLLKCQQEGLVPEGGAEGERDHWQQFYFLS
KRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDCGVEFIHDESVKKYFASSFEWCR
KAQVIDLQAEGYWEELLDTTQPAIVAKDWYSGRSDAGCLYELTVRLLSEHEDVLAEFSSG
QVAVPPDGDDGGWVQISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Download sequence
Identical sequences E2RGF8
ENSCAFP00000006864 ENSCAFP00000006864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]