SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RH84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RH84
Domain Number 1 Region: 182-329
Classification Level Classification E-value
Superfamily Cyclin-like 1.56e-76
Family Cyclin 0.000000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2RH84
Sequence length 370
Comment (tr|E2RH84|E2RH84_CANLF) Cyclin-dependent kinase 5 activator {ECO:0000256|PIRNR:PIRNR009324} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=CDK5R2 OC=Canis.
Sequence
MGTVLSLSPASSAKGRRPGGLPEEKKKAPPVGDEALGGYGAPPAGKGGKGESRLKRPSVL
ISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDPPDGGGATKP
LAVPVPTVPAAAATCEPPSGGSAAAPPPGSGGGKPPPPPPPAQQAAPPVPGGSPRRVIMQ
ASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVY
LLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRL
IQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAAGAGGPPSGGAPAAPAAASAARDSCATG
AKHWTMNLDR
Download sequence
Identical sequences E2RH84
XP_005640725.1.84170 ENSCAFP00000022073 ENSCAFP00000022073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]