SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RHK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RHK9
Domain Number 1 Region: 22-167
Classification Level Classification E-value
Superfamily PH domain-like 4e-57
Family Ran-binding domain 0.000000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2RHK9
Sequence length 209
Comment (tr|E2RHK9|E2RHK9_CANLF) RAN binding protein 1 {ECO:0000313|Ensembl:ENSCAFP00000020890} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=RANBP1 OC=Canis.
Sequence
MAAAKDTHEDHDTSTENADESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFAS
ENDLPEWKERGTGDVKLLKHKEKGTIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW
VWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRKEIEEREKKAGSGKNDDAEKV
TEKLEALSVKEESKESEDTESKAGAEEEQ
Download sequence
Identical sequences E2RHK9
ENSCAFP00000020890 XP_004414964.1.74151 XP_005636631.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]