SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RHR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RHR2
Domain Number 1 Region: 297-439
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 193-298
Classification Level Classification E-value
Superfamily Second domain of FERM 6.67e-37
Family Second domain of FERM 0.00000297
Further Details:      
 
Domain Number 3 Region: 112-192
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-27
Family First domain of FERM 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2RHR2
Sequence length 804
Comment (tr|E2RHR2|E2RHR2_CANLF) Erythrocyte membrane protein band 4.1 like 3 {ECO:0000313|Ensembl:ENSCAFP00000027414} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=EPB41L3 OC=Canis.
Sequence
MTTESGSDSESKPEQEAEPQEAAGTQGPVGAPQGPGPEPSGEEQHQVLEQFEAAAHSTPV
KKEVTDKEREFAAGAAKQLEYQQLEDDKLSQKSSSSKLSRSPLKIVKKPKSMQCKVILLD
GSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQIRSG
AWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELG
DYDPDECGNDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGV
DLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQ
FESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRR
ASALIDRPAPYFERSSSKRYTMSRSLDGASVNENHEIYMKDSVSAAEVGTGQYATTKGIS
QTNLITTVTPEKKAEEERDEEEDRRKKAEEATPVAAARHEGKTDSERTDTAADGETTATE
ELDKTQDDLMKHQTNISELKRTFLETSTDTAITNEWEKRLSTSPVRLAARQEDAPMIEPL
VPEEKTETKTESSKTETETSHLAPSPQPLSTEKEETAAASHEPEEEQSTTTHVPETREQK
PHFESSTVKTESLSFGSVSPGGVKLEISTKEVPVVHTETKTITYESSQVDAGADLEPGVL
MSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQ
HPDMSVTKVVVHKETEITPEDGED
Download sequence
Identical sequences E2RHR2
ENSCAFP00000027414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]