SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RI76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RI76
Domain Number 1 Region: 63-168
Classification Level Classification E-value
Superfamily Cyclin-like 1.81e-32
Family Cyclin 0.001
Further Details:      
 
Domain Number 2 Region: 172-262
Classification Level Classification E-value
Superfamily Cyclin-like 0.00000000115
Family Cyclin 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2RI76
Sequence length 290
Comment (tr|E2RI76|E2RI76_CANLF) Cyclin O {ECO:0000313|Ensembl:ENSCAFP00000010076} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=CCNO OC=Canis.
Sequence
MCIHTRRRARYEPDHRFGRSSAVPVFPSLQHIEVFLFCLVPQGRSLSFLDWFLLRALLPC
PPMSPRQVTAESRCKLLSWLIPVHRQFRLSFESLCLTVNTLDRFLTTTPVAADCFQLLGV
TSLLIACKQVEVHPPRVKQLLALCCGAFSRQQLCNLECIVLHKLHFSLGAPTISFFLEHF
THARVEAGQAEVSEALEAQALARGVAELSLADYAFTSYTPSLLAICCLALADRMLQLPRP
VDLRLGGHPEAALQDCLGKLQLLVAINEASLTHMLPFQIREKCSLSPKLK
Download sequence
Identical sequences E2RI76
ENSCAFP00000010076 ENSCAFP00000010076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]