SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RI87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RI87
Domain Number 1 Region: 29-227
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.74e-75
Family STAT DNA-binding domain 0.000000479
Further Details:      
 
Domain Number 2 Region: 780-991
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.57e-75
Family STAT DNA-binding domain 0.00000000802
Further Details:      
 
Domain Number 3 Region: 599-780
Classification Level Classification E-value
Superfamily STAT 9.81e-63
Family STAT 0.0000000158
Further Details:      
 
Domain Number 4 Region: 466-586
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 8.76e-44
Family Transcription factor STAT-4 N-domain 0.0000193
Further Details:      
 
Domain Number 5 Region: 992-1133
Classification Level Classification E-value
Superfamily SH2 domain 1.06e-42
Family SH2 domain 0.000000141
Further Details:      
 
Domain Number 6 Region: 228-348
Classification Level Classification E-value
Superfamily SH2 domain 6.46e-42
Family SH2 domain 0.00000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2RI87
Sequence length 1173
Comment (tr|E2RI87|E2RI87_CANLF) Signal transducer and activator of transcription {ECO:0000256|RuleBase:RU046415} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=STAT1 OC=Canis.
Sequence
MTYEGDPIPMQRAHLLERVTFLIYNLFKKLLIKLPELNYQVKVKASIDNNRRFVLCGTHV
KAMSIEESSNGSLSVEFRHLGCHMVTEELHSITFETQICLYGLTIDLETSSLPVVMISNV
SQLPNAWASIIWYNVSTNDSQNLVFFNNPPSATLSQLLEVMSWQFSSYVGRGLNSDQLNM
LAEKLTAQSSYNDGHLTWAKFCKEHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGF
VSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDHSENGEVRFHSVEPYNKGRLSALP
FADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVVVLNHLVQLWPWASG
LRSRSHASEAQALPAASLSGVWKMRQSALPVGGVVGEETAGTSNRLPLWCQGSLLSQGQL
RAPTIFLLFFPWKEIRGVDLCTSNCYAKTDLHLSKEDESPDSFQRMSQWYELQQLDSKFL
EQVHQLYDDCFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLEN
NFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYNCLKEERKILENAQRFNQAQSGNVQSTVM
LDKQKELDSKVRNVKDKVMCIEHEIKTLEDLQDEYDFKCKTLQNREHEANGVAKNDQKQE
QMLIQKMYLMLDNKRKEVVLKIIELLNVTELTQKALINDELVEWKRRQQSACIGGPPNAC
LDQLQNWFTVVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQGLWDRTFNLFQQLIQR
LLVKLQELNYNLKVKVLFDKDVSERNTVKGYSNDPEPLRCLYSVLSRFRKFNILGTHTKV
MNMEESTNGSLAAEFRHLQLKEQKNAGTRTNETTSLPVVVISNVSQLPSGWASILWYNML
VTEPRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNAGPDGLI
PWTRFCKENINDKNFPFWLWIESILELIKKHLLSLWNDGCIVGFISKERERALLKDQQPG
TFLLRFSESCREGAITFTWVERAQGGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAE
NIPENPLKFLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRL
QTTDNLLPMSPEEFDEVSRIVGSVEFDSMVSWR
Download sequence
Identical sequences E2RI87
ENSCAFP00000014423 ENSCAFP00000014654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]