SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RI99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RI99
Domain Number 1 Region: 317-568
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.33e-109
Family STAT DNA-binding domain 0.000000000311
Further Details:      
 
Domain Number 2 Region: 134-317
Classification Level Classification E-value
Superfamily STAT 2.16e-65
Family STAT 0.0000000144
Further Details:      
 
Domain Number 3 Region: 1-121
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 7.72e-44
Family Transcription factor STAT-4 N-domain 0.0000193
Further Details:      
 
Domain Number 4 Region: 569-710
Classification Level Classification E-value
Superfamily SH2 domain 5.39e-43
Family SH2 domain 0.000000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2RI99
Sequence length 750
Comment (tr|E2RI99|E2RI99_CANLF) Signal transducer and activator of transcription {ECO:0000256|RuleBase:RU046415} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=STAT1 OC=Canis.
Sequence
MSQWYELQQLDSKFLEQVHQLYDDCFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYNCLKEERKILENAQ
RFNQAQSGNVQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKTLEDLQDEYDFKCKTLQNR
EHEANGVAKNDQKQEQMLIQKMYLMLDNKRKEVVLKIIELLNVTELTQKALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTVVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQG
LWDRTFNLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVSERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVTE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLSLWNDGCIVGFISKERERALLKDQQPGTFL
LRFSESCREGAITFTWVERAQGGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKFLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGSVEFDSMMHAV
Download sequence
Identical sequences E2RI99
XP_848353.1.84170 ENSCAFP00000014419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]