SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RJD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RJD3
Domain Number 1 Region: 110-218
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-28
Family Second domain of FERM 0.0028
Further Details:      
 
Domain Number 2 Region: 220-361
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-24
Family Third domain of FERM 0.0026
Further Details:      
 
Domain Number 3 Region: 16-110
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-16
Family First domain of FERM 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2RJD3
Sequence length 614
Comment (tr|E2RJD3|E2RJD3_CANLF) FERM domain containing 6 {ECO:0000313|Ensembl:ENSCAFP00000021577} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=FRMD6 OC=Canis.
Sequence
MNKLNFHNNRVMQDRRSVCIFLPNDESLNIIINVKILCHQLLVQVCDLLRLKDCHLFGLS
VIQNNEHVYMELSQKLYKYCPKEWKKEASKGIDQFGPPMIIHFRVQYYVENGRLISDRAA
RYYYYWHLRKQVLHSQCVLREEAYFLLAAFALQADLGNFKRNKHYGKYFEPEAYFPAWVV
SKRGKDYILKHIPNMHKDQFALTASEAHLKYIKEAVRLDDVAVHYYRLYKDKREIEASLT
LGLTMRGIQIFQNLDEEKQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKLIYYTGCPM
RSRHLLQLLSNSHRLYMNLQPVLRHIRKLEENEEKKQYRESYISDSLDLDVDQLEKRSRA
SGSSAGSVKHKRLSRHSTASHSSSHTSGIEADTKPRDTGPEDSYSGSAIHRKLKSCSSMT
SHGSSHTSGVESSGKDRLEEDSQDDEIEMLVDDPRDLEQMNEESLEVSPDMCIYITEDML
MSRKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDRHSLSLDDI
RLYQKDFLRIAGLCQDTAQSYTFGCGHELDEEGLYCNSCLAQQCVNIQDAFPVKRTSKYF
SLDLTHDEVPEFVV
Download sequence
Identical sequences E2RJD3
ENSCAFP00000021577 ENSCAFP00000021577 XP_864050.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]