SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RK64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RK64
Domain Number 1 Region: 360-455
Classification Level Classification E-value
Superfamily PH domain-like 5.21e-19
Family Pleckstrin-homology domain (PH domain) 0.0097
Further Details:      
 
Domain Number 2 Region: 553-641
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-18
Family Third domain of FERM 0.004
Further Details:      
 
Domain Number 3 Region: 256-300
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000877
Family Second domain of FERM 0.0076
Further Details:      
 
Domain Number 4 Region: 468-552
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000144
Family Second domain of FERM 0.0061
Further Details:      
 
Weak hits

Sequence:  E2RK64
Domain Number - Region: 16-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.075
Family Ubiquitin-related 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2RK64
Sequence length 666
Comment (tr|E2RK64|E2RK64_CANLF) Fermitin family member 3 {ECO:0000313|Ensembl:ENSCAFP00000021567} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=FERMT3 OC=Canis.
Sequence
MAGMKTATGDYIDSSWELRVFVGEDDPEAESVTLRVTGESHIGGVLLKIVEEIKRKQDWS
DHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRALRLRASFSQPL
FQAVAAICRLLSIRHPEELSLLRAPEKKEKKKKEKEPEEELYDLTKVVLAGGVAPALFRG
MPAHFSDSAQTEACYHMLSRPQPPPDPLLLQRLPRPSSLLDKTQLHSRWLDSSRCLMQQG
IKTGDMLWLRFSRSFFDLDPKTDPVRLTQLYEQARWDLLLEETDCTEEEMMVFAALQYHI
NKLSQSGEVGETAGTDLGLDDLDAALNNLEVKLEGSASTDVLNNLTTIPELKDHLRIFRL
AFRPRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGCEVVPDVNVSGQKFC
IKLLVPSPEGMSEIYLRCQDEKQYARWMAGCRLASKGRTMADSSYASEVQAILAFLSLQR
TGGGGSGNHPQGPDASAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLSEAQL
RFIQAWQSLPDFGISYIVVRFKGSKKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWN
VNWDIRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLT
GGHEAF
Download sequence
Identical sequences E2RK64
9615.ENSCAFP00000021567 ENSCAFP00000021567 ENSCAFP00000021567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]