SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RMJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RMJ5
Domain Number 1 Region: 37-341
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.83e-102
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000538
Further Details:      
 
Domain Number 2 Region: 348-522
Classification Level Classification E-value
Superfamily An anticodon-binding domain of class I aminoacyl-tRNA synthetases 7.59e-20
Family C-terminal domain of glutamyl-tRNA synthetase (GluRS) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2RMJ5
Sequence length 524
Comment (tr|E2RMJ5|E2RMJ5_CANLF) Glutamyl-tRNA synthetase 2, mitochondrial {ECO:0000313|Ensembl:ENSCAFP00000026064} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=EARS2 OC=Canis.
Sequence
MALLLKRLLWPVRPLAPLGRPVGRRAASVGADAGPAVRVRFAPSPTGFLHLGGLRTALYN
YIFAKKHQGSFILRLEDTDQTRLVPGAAENIEAMLEWAGIPPDESPRRGGPVGPYQQSQR
LELYAQATKALLESGAAYPCFCSPQRLDLLKKEALRNRQTPRRYDNRCRNLTQKQVAQKL
AKDPKPAIRFRLEGEAPAFQDLVYGWNRHEVASVEGDPVILKSDGFPTYHLACVVDDHHM
GISHVLRGSEWLVSTSKHLLLYQALGWQPPRFAHLPLLLNKDGSKLSKRQGDIFLEQFAA
ADFLPDALLDIITNCGSGFAENQMGRTLPELITQFDLTRITCHSALLDLDKLPEFNRLHL
CRLVSNETQRRQLVGKLQALVEETFGSQLQDRDVLDPAYVERIILLRQGHICRLQDLVSP
AHSYLWTRPAVGRVQLGTISEKVDAIAKRVLGILEAPSISLTQDMLNRELKKVSEGLEGT
RHSTVMQFLRVALSGQLQGPPVAEMMVSLGVKEVRERIQKVLSS
Download sequence
Identical sequences E2RMJ5
ENSCAFP00000026064 ENSCAFP00000026064 9615.ENSCAFP00000026064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]